PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010922873.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 361aa    MW: 40562.7 Da    PI: 7.0996
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010922873.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1782.6e-55151421129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdee++++yL +kv + ++++ +++ evd++k+ePwdLp+k+k +ekewyfF+++ kky+tg r nrat+sgyWkatgkdke+++ 
  XP_010922873.1  15 LPPGFRFHPTDEEIITYYLSEKVVNPSFTA-RAMGEVDLNKCEPWDLPSKAKMGEKEWYFFCQKGKKYPTGVRINRATESGYWKATGKDKEIYRG 108
                     79*************************999.89***************99999****************************************** PP

             NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                     kg lvg+kktLvfykgrapkgekt+Wvmhe+rle
  XP_010922873.1 109 KGILVGMKKTLVFYKGRAPKGEKTNWVMHEFRLE 142
                     *******************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-6212166IPR003441NAC domain
PROSITE profilePS5100558.7215166IPR003441NAC domain
PfamPF023659.0E-2816141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MGEVPVLAEE ECMDLPPGFR FHPTDEEIIT YYLSEKVVNP SFTARAMGEV DLNKCEPWDL  60
PSKAKMGEKE WYFFCQKGKK YPTGVRINRA TESGYWKATG KDKEIYRGKG ILVGMKKTLV  120
FYKGRAPKGE KTNWVMHEFR LEGRTQFYNH HRTPKDGWVV CRVFHKSTGI KRSPISELAR  180
MNSSGDDTME TLMDPSYFNS DNTPSSSFID GGDGGSTVRG ISMTSMPSNF STMLGLEDPQ  240
YKSPMANIFP SINNQERTSM LFQQIPAQNP YFLLPGSANL SYLQQEQAIA KALSNGLKGT  300
CKLEQFSNSM ASQDTGLSND RNTESSSAIS KHEMSSYRSY NELDGGFAAG PVLDLDNLWK  360
Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-511317215171NO APICAL MERISTEM PROTEIN
1ut4_B1e-511317215171NO APICAL MERISTEM PROTEIN
1ut7_A1e-511317215171NO APICAL MERISTEM PROTEIN
1ut7_B1e-511317215171NO APICAL MERISTEM PROTEIN
3swm_A1e-511317218174NAC domain-containing protein 19
3swm_B1e-511317218174NAC domain-containing protein 19
3swm_C1e-511317218174NAC domain-containing protein 19
3swm_D1e-511317218174NAC domain-containing protein 19
3swp_A1e-511317218174NAC domain-containing protein 19
3swp_B1e-511317218174NAC domain-containing protein 19
3swp_C1e-511317218174NAC domain-containing protein 19
3swp_D1e-511317218174NAC domain-containing protein 19
4dul_A1e-511317215171NAC domain-containing protein 19
4dul_B1e-511317215171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010922873.10.0PREDICTED: NAC domain-containing protein 100-like
TrEMBLM0T5A91e-133M0T5A9_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P08600_0011e-133(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP186238104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-99NAC domain containing protein 100